Determination of Surface-active Agent. IV
نویسندگان
چکیده
منابع مشابه
selective complexmetric determination of titanum (iv) by using 5-sulphosalicylic acid as releasing agent
a complexometric method for the determination of titanium in the presence of other metal ions based on the selective masking ability of 5-sulphosalicylic acid towards titanium is described. titanium (iv) present in a given sample solution is complexed with a known excess of edta and surplus edta is titrated against zinc sulphate solution at ph 5-6 using xylenol orange as the indicator. a known ...
متن کاملCatalytic Spectrophotometric Determination of Traces of Tellurium (IV)
A Simple, rapid and sensitive method has been developed for determination of trances of tellurium (VI) (0.096-1.250 mg/mL) based on its catalytic effect on the reduction reaction of toluidine blue by sulfide ion at pH 4. The reaction is monitored spectrophotometrically by measuring the decrease in absorbance of the dyestuff at 628 nm by the fixed time method. The detection...
متن کاملApplication of Cerium (IV) as an Oxidimetric Agent for the Determination of Ethionamide in Pharmaceutical Formulations
Two simple methods are described for the determination of ethionamide (ETM) in bulk drug and tablets using cerium (IV) sulphate as the oxidimetric agent. In both methods, the sample solution is treated with a measured excess of cerium (IV) solution in H2SO4 medium, and after a fixed standing time, the residual oxidant is determined either by back titration with standard iron (II) solution to a ...
متن کاملStructure--activity relationships of hainantoxin-IV and structure determination of active and inactive sodium channel blockers.
Hainantoxin-IV (HNTX-IV) can specifically inhibit the neuronal tetrodotoxin-sensitive sodium channels and defines a new class of depressant spider toxin. The sequence of native HNTX-IV is ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH(2). In the present study, to obtain further insight into the primary and tertiary structural requirements of neuronal sodium channel blockers, we determined the solution ...
متن کاملAssessment of Heavy Metal Contamination in Surface Soils of Ahvaz IV Industrial Estate, Khuzestan Province, Iran
Background and Purpose: In the environment, heavy metals in high concentration are toxic to most organisms. Human activities have continuously increased the concentration of these metals in the environment such as soils. In the present study, soil samples collected from Ahvaz IV industrial estate in Khuzestan Province. Materials and Methods: The soil samples were taken from 9 ...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: YAKUGAKU ZASSHI
سال: 1962
ISSN: 0031-6903,1347-5231
DOI: 10.1248/yakushi1947.82.7_1017